Original
skype;Candice148722
whatsApp:8618038176817
if you are interested in my products,pls contact me,thanks
Quick Details:
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
IGF-1 LR3 (Long R3 IGF-1)
Product Descript ion:
The Sequence of IGF-1 LR3 and Muscle Growth
The polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated.
